SCOP 1.65: Domain d1eyxl_: 1eyx L:

Lineage for d1eyxl_ (1eyx L:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (6 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore

6. Protein Phycoerythrin beta subunit [88513] (4 species)

7. Species Red algae (Gracilaria chilensis) [TaxId:2775] [88516] (1 PDB entry)

8. Domain d1eyxl_: 1eyx L: [15672]
   Other proteins in same PDB: d1eyxa_, d1eyxk_
   complexed with cyc, pub, so4

Details for d1eyxl_

PDB Entry: 1eyx, 2.25 Å

PDB Description: crystal structure of r-phycoerythrin at 2.2 angstroms

SCOP Domain Sequences for d1eyxl_:

Sequence; same for both SEQRES and ATOM records:

>d1eyxl_ a.1.1.3 (L:) Phycoerythrin beta subunit {Red algae (Gracilaria chilensis)}
mldafsrvisnadakaayvggsdlqalrtfisdgnkrldavnyivsnsscivsdaisgmi
cenpglitpggncytnrrmaaclrdgeiilryisyallagdssvledrclnglketyial
gvptnstvravsimkaavgafisntasqrkgeviegdcsalaaeiasycdrisaavs

Timeline for d1eyxl_:

• d1eyxl_ first appeared (with stable ids) in SCOP 1.55
  
• d1eyxl_ appears in SCOP 1.63
  
• d1eyxl_ appears in SCOP 1.67
  
• d1eyxl_ appears in the current release, SCOPe 2.08