| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily) beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123 |
Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family) ![]() |
| Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins) Pfam PF03946 |
| Protein Ribosomal protein L11, N-terminal domain [54749] (4 species) |
| Species Thermus thermophilus [TaxId:274] [160200] (13 PDB entries) Uniprot P36238 1-70! Uniprot P36238 2-68! Uniprot P36238 2-70 |
| Domain d3cjtf2: 3cjt F:2-68 [156719] Other proteins in same PDB: d3cjtb1, d3cjtf1, d3cjtj1, d3cjtn1 automatically matched to 2HGJ L:2-68 complexed with 2mm, cl, edo, no3, sah, sam; mutant |
PDB Entry: 3cjt (more details), 2.3 Å
SCOP Domain Sequences for d3cjtf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cjtf2 d.47.1.1 (F:2-68) Ribosomal protein L11, N-terminal domain {Thermus thermophilus [TaxId: 274]}
kkvvavvklqlpagkatpappvgpalgqhganimefvkafnaatanmgdaivpveitiya
drsftfv
Timeline for d3cjtf2: