SCOPe 2.08: Domain d3cjtf2: 3cjt F:2-68

Lineage for d3cjtf2 (3cjt F:2-68)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily)
   beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123

4. Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family)

5. Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins)
   Pfam PF03946

6. Protein Ribosomal protein L11, N-terminal domain [54749] (4 species)

7. Species Thermus thermophilus [TaxId:274] [160200] (17 PDB entries)
   Uniprot P36238 1-70! Uniprot P36238 2-68! Uniprot P36238 2-70

8. Domain d3cjtf2: 3cjt F:2-68 [156719]
   Other proteins in same PDB: d3cjtb1, d3cjtf1, d3cjtj1, d3cjtn1
   automatically matched to 2HGJ L:2-68
   protein/RNA complex; complexed with 2mm, cl, edo, no3, sah, sam

Details for d3cjtf2

PDB Entry: 3cjt, 2.3 Å

PDB Description: ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11

PDB Compounds: (F:) 50S ribosomal protein L11

SCOPe Domain Sequences for d3cjtf2:

Sequence; same for both SEQRES and ATOM records:

>d3cjtf2 d.47.1.1 (F:2-68) Ribosomal protein L11, N-terminal domain {Thermus thermophilus [TaxId: 274]}
kkvvavvklqlpagkatpappvgpalgqhganimefvkafnaatanmgdaivpveitiya
drsftfv

Timeline for d3cjtf2:

• d3cjtf2 first appeared in SCOP 1.75
  
• d3cjtf2 appears in SCOPe 2.07