![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily) beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123 |
![]() | Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family) ![]() |
![]() | Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins) Pfam PF03946 |
![]() | Protein Ribosomal protein L11, N-terminal domain [54749] (4 species) |
![]() | Species Thermus thermophilus [TaxId:274] [160200] (17 PDB entries) Uniprot P36238 1-70! Uniprot P36238 2-68! Uniprot P36238 2-70 |
![]() | Domain d3cjqe2: 3cjq E:2-70 [156707] Other proteins in same PDB: d3cjqa1, d3cjqb1, d3cjqd1, d3cjqe1, d3cjqg1, d3cjqh1 automatically matched to 3CJR B:1-70 protein/RNA complex; complexed with 2mm, iod, sah |
PDB Entry: 3cjq (more details), 2.7 Å
SCOPe Domain Sequences for d3cjqe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cjqe2 d.47.1.1 (E:2-70) Ribosomal protein L11, N-terminal domain {Thermus thermophilus [TaxId: 274]} kkvvavvklqlpagkatpappvgpalgqhganimefvaafnaatanmgdaivpveitiya drsftfvtk
Timeline for d3cjqe2: