Lineage for d3cjoa1 (3cjo A:18-362)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 830794Family c.37.1.9: Motor proteins [52641] (4 proteins)
  6. 830795Protein Kinesin [52646] (7 species)
  7. 830799Species Human (Homo sapiens), mitotic kinesin eg5 [TaxId:9606] [64018] (17 PDB entries)
  8. 830826Domain d3cjoa1: 3cjo A:18-362 [156700]
    automatically matched to d1q0bb_
    complexed with adp, k30, mg

Details for d3cjoa1

PDB Entry: 3cjo (more details), 2.28 Å

PDB Description: Crystal structure of KSP in complex with inhibitor 30
PDB Compounds: (A:) Kinesin-like protein KIF11

SCOP Domain Sequences for d3cjoa1:

Sequence, based on SEQRES records: (download)

>d3cjoa1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]}
niqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfgastk
qidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagiip
rtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgviik
gleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeelvk
igklnlvdlagsenigrsgavdkrareagninqslltlgrvitalvertphvpyresklt
rilqdslggrtrtsiiatispaslnleetlstleyahraknilnk

Sequence, based on observed residues (ATOM records): (download)

>d3cjoa1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]}
niqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfgastk
qidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagiip
rtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgviik
gleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeelvk
igklnlvdlagsenninqslltlgrvitalvertphvpyreskltrilqdslggrtrtsi
iatispaslnleetlstleyahraknilnk

SCOP Domain Coordinates for d3cjoa1:

Click to download the PDB-style file with coordinates for d3cjoa1.
(The format of our PDB-style files is described here.)

Timeline for d3cjoa1: