Lineage for d1eyxb_ (1eyx B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1979008Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 1979176Protein Phycoerythrin beta subunit [88513] (4 species)
  7. 1979190Species Red algae (Gracilaria chilensis) [TaxId:2775] [88516] (1 PDB entry)
  8. 1979191Domain d1eyxb_: 1eyx B: [15670]
    Other proteins in same PDB: d1eyxa_, d1eyxk_
    complexed with bla, cyc, pub, so4

Details for d1eyxb_

PDB Entry: 1eyx (more details), 2.25 Å

PDB Description: crystal structure of r-phycoerythrin at 2.2 angstroms
PDB Compounds: (B:) r-phycoerythrin

SCOPe Domain Sequences for d1eyxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eyxb_ a.1.1.3 (B:) Phycoerythrin beta subunit {Red algae (Gracilaria chilensis) [TaxId: 2775]}
mldafsrvisnadakaayvggsdlqalrtfisdgnkrldavnyivsnsscivsdaisgmi
cenpglitpggncytnrrmaaclrdgeiilryisyallagdssvledrclnglketyial
gvptnstvravsimkaavgafisntasqrkgeviegdcsalaaeiasycdrisaavs

SCOPe Domain Coordinates for d1eyxb_:

Click to download the PDB-style file with coordinates for d1eyxb_.
(The format of our PDB-style files is described here.)

Timeline for d1eyxb_: