Lineage for d1eyxb_ (1eyx B:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 349260Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 349261Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 350323Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (6 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
  6. 350440Protein Phycoerythrin beta subunit [88513] (4 species)
  7. 350450Species Red algae (Gracilaria chilensis) [TaxId:2775] [88516] (1 PDB entry)
  8. 350451Domain d1eyxb_: 1eyx B: [15670]
    Other proteins in same PDB: d1eyxa_, d1eyxk_

Details for d1eyxb_

PDB Entry: 1eyx (more details), 2.25 Å

PDB Description: crystal structure of r-phycoerythrin at 2.2 angstroms

SCOP Domain Sequences for d1eyxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eyxb_ a.1.1.3 (B:) Phycoerythrin beta subunit {Red algae (Gracilaria chilensis)}
mldafsrvisnadakaayvggsdlqalrtfisdgnkrldavnyivsnsscivsdaisgmi
cenpglitpggncytnrrmaaclrdgeiilryisyallagdssvledrclnglketyial
gvptnstvravsimkaavgafisntasqrkgeviegdcsalaaeiasycdrisaavs

SCOP Domain Coordinates for d1eyxb_:

Click to download the PDB-style file with coordinates for d1eyxb_.
(The format of our PDB-style files is described here.)

Timeline for d1eyxb_: