Class a: All alpha proteins [46456] (179 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) |
Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (6 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore |
Protein Phycoerythrin beta subunit [88513] (4 species) |
Species Red algae (Gracilaria chilensis) [TaxId:2775] [88516] (1 PDB entry) |
Domain d1eyxb_: 1eyx B: [15670] Other proteins in same PDB: d1eyxa_, d1eyxk_ |
PDB Entry: 1eyx (more details), 2.25 Å
SCOP Domain Sequences for d1eyxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eyxb_ a.1.1.3 (B:) Phycoerythrin beta subunit {Red algae (Gracilaria chilensis)} mldafsrvisnadakaayvggsdlqalrtfisdgnkrldavnyivsnsscivsdaisgmi cenpglitpggncytnrrmaaclrdgeiilryisyallagdssvledrclnglketyial gvptnstvravsimkaavgafisntasqrkgeviegdcsalaaeiasycdrisaavs
Timeline for d1eyxb_: