| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein Hemoglobin, alpha-chain [46486] (24 species) |
| Species Cow (Bos taurus) [TaxId:9913] [46490] (12 PDB entries) |
| Domain d3ciuc1: 3ciu C:1-141 [156695] Other proteins in same PDB: d3ciub1, d3ciud1 automatically matched to d1fsxa_ complexed with 5dp, hem, o |
PDB Entry: 3ciu (more details), 3.5 Å
SCOPe Domain Sequences for d3ciuc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ciuc1 a.1.1.2 (C:1-141) Hemoglobin, alpha-chain {Cow (Bos taurus) [TaxId: 9913]}
vlsaadkgnvkaawgkvgghaaeygaealermflsfpttktyfphfdlshgsaqvkghga
kvaaaltkavehlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpa
vhasldkflanvstvltskyr
Timeline for d3ciuc1: