![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (4 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (26 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, alpha-chain [46486] (20 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [46490] (8 PDB entries) |
![]() | Domain d3ciuc1: 3ciu C:1-141 [156695] Other proteins in same PDB: d3ciub1, d3ciud1 automatically matched to d1fsxa_ complexed with 5dp, hem, o |
PDB Entry: 3ciu (more details), 3.5 Å
SCOP Domain Sequences for d3ciuc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ciuc1 a.1.1.2 (C:1-141) Hemoglobin, alpha-chain {Cow (Bos taurus) [TaxId: 9913]} vlsaadkgnvkaawgkvgghaaeygaealermflsfpttktyfphfdlshgsaqvkghga kvaaaltkavehlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpa vhasldkflanvstvltskyr
Timeline for d3ciuc1: