Lineage for d3ciuc1 (3ciu C:1-141)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 758334Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 758373Family a.1.1.2: Globins [46463] (26 proteins)
    Heme-binding protein
  6. 758539Protein Hemoglobin, alpha-chain [46486] (20 species)
  7. 758570Species Cow (Bos taurus) [TaxId:9913] [46490] (8 PDB entries)
  8. 758586Domain d3ciuc1: 3ciu C:1-141 [156695]
    Other proteins in same PDB: d3ciub1, d3ciud1
    automatically matched to d1fsxa_
    complexed with 5dp, hem, o

Details for d3ciuc1

PDB Entry: 3ciu (more details), 3.5 Å

PDB Description: Site-Selective Glycosylation of Cysteine-93 beta on the Surface of Bovine Hemoglobin and its Application as a Novel Oxygen Therapeutic
PDB Compounds: (C:) Hemoglobin subunit alpha

SCOP Domain Sequences for d3ciuc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ciuc1 a.1.1.2 (C:1-141) Hemoglobin, alpha-chain {Cow (Bos taurus) [TaxId: 9913]}
vlsaadkgnvkaawgkvgghaaeygaealermflsfpttktyfphfdlshgsaqvkghga
kvaaaltkavehlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpsdftpa
vhasldkflanvstvltskyr

SCOP Domain Coordinates for d3ciuc1:

Click to download the PDB-style file with coordinates for d3ciuc1.
(The format of our PDB-style files is described here.)

Timeline for d3ciuc1: