Lineage for d3ciub1 (3ciu B:2-146)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687001Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2687041Species Cow (Bos taurus) [TaxId:9913] [46506] (13 PDB entries)
  8. 2687066Domain d3ciub1: 3ciu B:2-146 [156694]
    Other proteins in same PDB: d3ciua1, d3ciuc1
    automatically matched to d1fsxb_
    complexed with 5dp, hem, o

Details for d3ciub1

PDB Entry: 3ciu (more details), 3.5 Å

PDB Description: Site-Selective Glycosylation of Cysteine-93 beta on the Surface of Bovine Hemoglobin and its Application as a Novel Oxygen Therapeutic
PDB Compounds: (B:) Hemoglobin subunit beta

SCOPe Domain Sequences for d3ciub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ciub1 a.1.1.2 (B:2-146) Hemoglobin, beta-chain {Cow (Bos taurus) [TaxId: 9913]}
mltaeekaavtafwgkvkvdevggealgrllvvypwtqrffesfgdlstadavmnnpkvk
ahgkkvldsfsngmkhlddlkgtfaalselhcdklhvdpenfkllgnvlvvvlarnfgke
ftpvlqadfqkvvagvanalahryh

SCOPe Domain Coordinates for d3ciub1:

Click to download the PDB-style file with coordinates for d3ciub1.
(The format of our PDB-style files is described here.)

Timeline for d3ciub1: