![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, beta-chain [46500] (26 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [46506] (13 PDB entries) |
![]() | Domain d3ciub1: 3ciu B:2-146 [156694] Other proteins in same PDB: d3ciua1, d3ciuc1 automatically matched to d1fsxb_ complexed with 5dp, hem, o |
PDB Entry: 3ciu (more details), 3.5 Å
SCOPe Domain Sequences for d3ciub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ciub1 a.1.1.2 (B:2-146) Hemoglobin, beta-chain {Cow (Bos taurus) [TaxId: 9913]} mltaeekaavtafwgkvkvdevggealgrllvvypwtqrffesfgdlstadavmnnpkvk ahgkkvldsfsngmkhlddlkgtfaalselhcdklhvdpenfkllgnvlvvvlarnfgke ftpvlqadfqkvvagvanalahryh
Timeline for d3ciub1: