| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore automatically mapped to Pfam PF00502 |
| Protein Phycoerythrin alpha subunit [88961] (3 species) |
| Species Red algae (Gracilaria chilensis) [TaxId:2775] [88512] (1 PDB entry) |
| Domain d1eyxa_: 1eyx A: [15669] Other proteins in same PDB: d1eyxb_, d1eyxl_ complexed with bla, cyc, pub, so4 |
PDB Entry: 1eyx (more details), 2.25 Å
SCOPe Domain Sequences for d1eyxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eyxa_ a.1.1.3 (A:) Phycoerythrin alpha subunit {Red algae (Gracilaria chilensis) [TaxId: 2775]}
mksvittvisaadsagrfpsssdlesvqgniqrasarleaaeklasnheavvkeagdacf
gkygylknpgeagenqekinkcyrdidhymrlvnyslviggtgpldewgiagarevyrtl
nlptsayiaafaftrdrlcgprdmsaqagveystaldyiinsls
Timeline for d1eyxa_: