Lineage for d1eyxa_ (1eyx A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1979008Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 1979166Protein Phycoerythrin alpha subunit [88961] (3 species)
  7. 1979173Species Red algae (Gracilaria chilensis) [TaxId:2775] [88512] (1 PDB entry)
  8. 1979174Domain d1eyxa_: 1eyx A: [15669]
    Other proteins in same PDB: d1eyxb_, d1eyxl_
    complexed with bla, cyc, pub, so4

Details for d1eyxa_

PDB Entry: 1eyx (more details), 2.25 Å

PDB Description: crystal structure of r-phycoerythrin at 2.2 angstroms
PDB Compounds: (A:) r-phycoerythrin

SCOPe Domain Sequences for d1eyxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eyxa_ a.1.1.3 (A:) Phycoerythrin alpha subunit {Red algae (Gracilaria chilensis) [TaxId: 2775]}
mksvittvisaadsagrfpsssdlesvqgniqrasarleaaeklasnheavvkeagdacf
gkygylknpgeagenqekinkcyrdidhymrlvnyslviggtgpldewgiagarevyrtl
nlptsayiaafaftrdrlcgprdmsaqagveystaldyiinsls

SCOPe Domain Coordinates for d1eyxa_:

Click to download the PDB-style file with coordinates for d1eyxa_.
(The format of our PDB-style files is described here.)

Timeline for d1eyxa_: