SCOP 1.75: Domain d3cirn1: 3cir N:106-243

Lineage for d3cirn1 (3cir N:106-243)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.2: alpha-helical ferredoxin [46548] (2 families)
   contains two Fe4-S4 clusters

5. Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (2 proteins)

6. Protein Fumarate reductase [46550] (2 species)

7. Species Escherichia coli [TaxId:562] [46551] (5 PDB entries)

8. Domain d3cirn1: 3cir N:106-243 [156689]
   Other proteins in same PDB: d3cira1, d3cira2, d3cira3, d3cirb2, d3circ1, d3cird1, d3cirm1, d3cirm2, d3cirm3, d3cirn2, d3ciro1, d3cirp1
   automatically matched to d1kf6b1
   complexed with f3s, fad, fes, sf4; mutant

Details for d3cirn1

PDB Entry: 3cir, 3.65 Å

PDB Description: e. coli quinol fumarate reductase frda t234a mutation

PDB Compounds: (N:) Fumarate reductase iron-sulfur subunit

SCOP Domain Sequences for d3cirn1:

Sequence; same for both SEQRES and ATOM records:

>d3cirn1 a.1.2.1 (N:106-243) Fumarate reductase {Escherichia coli [TaxId: 562]}
mthfiesleaikpyiignsrtadqgtniqtpaqmakyhqfsgcincglcyaacpqfglnp
efigpaaitlahrynedsrdhgkkermaqlnsqngvwsctfvgycsevcpkhvdpaaaiq
qgkvesskdfliatlkpr

Timeline for d3cirn1:

• d3cirn1 is new in SCOP 1.75
  
• d3cirn1 appears in SCOPe 2.01
  
• d3cirn1 appears in the current release, SCOPe 2.08