Lineage for d3cirb1 (3cir B:106-243)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 758333Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 760029Superfamily a.1.2: alpha-helical ferredoxin [46548] (2 families) (S)
    contains two Fe4-S4 clusters
  5. 760030Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (2 proteins)
  6. 760031Protein Fumarate reductase [46550] (2 species)
  7. 760032Species Escherichia coli [TaxId:562] [46551] (5 PDB entries)
  8. 760039Domain d3cirb1: 3cir B:106-243 [156682]
    Other proteins in same PDB: d3cira1, d3cira2, d3cira3, d3cirb2, d3circ1, d3cird1, d3cirm1, d3cirm2, d3cirm3, d3cirn2, d3ciro1, d3cirp1
    automatically matched to d1kf6b1
    complexed with f3s, fad, fes, sf4; mutant

Details for d3cirb1

PDB Entry: 3cir (more details), 3.65 Å

PDB Description: E. coli Quinol fumarate reductase FrdA T234A mutation
PDB Compounds: (B:) Fumarate reductase iron-sulfur subunit

SCOP Domain Sequences for d3cirb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cirb1 a.1.2.1 (B:106-243) Fumarate reductase {Escherichia coli [TaxId: 562]}
mthfiesleaikpyiignsrtadqgtniqtpaqmakyhqfsgcincglcyaacpqfglnp
efigpaaitlahrynedsrdhgkkermaqlnsqngvwsctfvgycsevcpkhvdpaaaiq
qgkvesskdfliatlkpr

SCOP Domain Coordinates for d3cirb1:

Click to download the PDB-style file with coordinates for d3cirb1.
(The format of our PDB-style files is described here.)

Timeline for d3cirb1: