Lineage for d1b8dl_ (1b8d L:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2302308Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 2302490Protein Phycoerythrin beta subunit [88513] (4 species)
  7. 2302498Species Red alga (Griffithsia monilis) [TaxId:42003] [88515] (1 PDB entry)
  8. 2302500Domain d1b8dl_: 1b8d L: [15668]
    Other proteins in same PDB: d1b8da_, d1b8dk_
    complexed with peb, pub

Details for d1b8dl_

PDB Entry: 1b8d (more details), 1.9 Å

PDB Description: crystal structure of a phycourobilin-containing phycoerythrin
PDB Compounds: (L:) protein (rhodophytan phycoerythrin (beta chain))

SCOPe Domain Sequences for d1b8dl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b8dl_ a.1.1.3 (L:) Phycoerythrin beta subunit {Red alga (Griffithsia monilis) [TaxId: 42003]}
mldafsrvvvtsdakaayvggsdlqslksfindgnkrldavnyivsnascivsdavsgmi
cenpgliapggncytnrrmaaclrdgeiilryvsyallagdssvlddrclnglketyial
gvptasssravsimkatatafitntasgrkvevaagdcqalqaeaasyfdkvgssid

SCOPe Domain Coordinates for d1b8dl_:

Click to download the PDB-style file with coordinates for d1b8dl_.
(The format of our PDB-style files is described here.)

Timeline for d1b8dl_: