SCOPe 2.05: Domain d1b8dl_: 1b8d L:

Lineage for d1b8dl_ (1b8d L:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore
   automatically mapped to Pfam PF00502

6. Protein Phycoerythrin beta subunit [88513] (4 species)

7. Species Red alga (Griffithsia monilis) [TaxId:42003] [88515] (1 PDB entry)

8. Domain d1b8dl_: 1b8d L: [15668]
   Other proteins in same PDB: d1b8da_, d1b8dk_
   complexed with peb, pub

Details for d1b8dl_

PDB Entry: 1b8d, 1.9 Å

PDB Description: crystal structure of a phycourobilin-containing phycoerythrin

PDB Compounds: (L:) protein (rhodophytan phycoerythrin (beta chain))

SCOPe Domain Sequences for d1b8dl_:

Sequence; same for both SEQRES and ATOM records:

>d1b8dl_ a.1.1.3 (L:) Phycoerythrin beta subunit {Red alga (Griffithsia monilis) [TaxId: 42003]}
mldafsrvvvtsdakaayvggsdlqslksfindgnkrldavnyivsnascivsdavsgmi
cenpgliapggncytnrrmaaclrdgeiilryvsyallagdssvlddrclnglketyial
gvptasssravsimkatatafitntasgrkvevaagdcqalqaeaasyfdkvgssid

Timeline for d1b8dl_:

• d1b8dl_ first appeared (with stable ids) in SCOP 1.55
  
• d1b8dl_ appears in SCOPe 2.04
  
• d1b8dl_ appears in SCOPe 2.06
  
• d1b8dl_ appears in the current release, SCOPe 2.08