Lineage for d1b8dl_ (1b8d L:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies) Superfamily a.1.1: Globin-like [46458] (3 families) 
Family a.1.1.3: Phycocyanins [46532] (5 proteins) Protein Phycoerythrin [46540] (5 species) 
Species Red alga (Griffithsia monilis) [TaxId:42003] [46542] (1 PDB entry) 
Domain d1b8dl_: 1b8d L: [15668]
Details for d1b8dl_
PDB Entry: 1b8d (more details), 1.9 Å
PDB Description: crystal structure of a phycourobilin-containing phycoerythrin
SCOP Domain Sequences for d1b8dl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b8dl_ a.1.1.3 (L:) Phycoerythrin {Red alga (Griffithsia monilis)}
mldafsrvvvtsdakaayvggsdlqslksfindgnkrldavnyivsnascivsdavsgmi
cenpgliapggncytnrrmaaclrdgeiilryvsyallagdssvlddrclnglketyial
gvptasssravsimkatatafitntasgrkvevaagdcqalqaeaasyfdkvgssid
SCOP Domain Coordinates for d1b8dl_:
Click to download the PDB-style file with coordinates for d1b8dl_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b8dl_:
- d1b8dl_ appears in SCOP 1.57
- d1b8dl_ appears in the current release, SCOPe 2.08
View in 3D
