![]() | Class a: All alpha proteins [46456] (179 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (4 families) ![]() |
![]() | Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (6 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore |
![]() | Protein Phycoerythrin alpha subunit [88961] (3 species) |
![]() | Species Red alga (Griffithsia monilis) [TaxId:42003] [88511] (1 PDB entry) |
![]() | Domain d1b8dk_: 1b8d K: [15667] Other proteins in same PDB: d1b8db_, d1b8dl_ complexed with peb, pub |
PDB Entry: 1b8d (more details), 1.9 Å
SCOP Domain Sequences for d1b8dk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b8dk_ a.1.1.3 (K:) Phycoerythrin alpha subunit {Red alga (Griffithsia monilis)} mksvitttisaadaagrfpsssdlesiqgniqraaarleaaqklsgnheavvkeagdacf akysylknageagdspekinkcyrdidhymrlinyslvvggtgpvdewgiagsrevyral nlpgsayiaaftftrdrlcvprdmssqagveftsaldyvinslc
Timeline for d1b8dk_: