Lineage for d3cida_ (3cid A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2067626Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2067627Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2069061Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2069119Protein beta-secretase (memapsin) [50671] (1 species)
  7. 2069120Species Human (Homo sapiens) [TaxId:9606] [50672] (281 PDB entries)
    Uniprot P56817 58-446 ! Uniprot P56817 60-447
  8. 2069181Domain d3cida_: 3cid A: [156668]
    automated match to d1fkna_
    complexed with 318, tar

Details for d3cida_

PDB Entry: 3cid (more details), 1.8 Å

PDB Description: structure of bace bound to sch726222
PDB Compounds: (A:) Beta-secretase 1

SCOPe Domain Sequences for d3cida_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cida_ b.50.1.2 (A:) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]}
gsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrql
sstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnwe
gilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsmii
ggidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrl
pkkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsf
ritilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfav
sachvhdefrtaavegpfvtldmedcgyni

SCOPe Domain Coordinates for d3cida_:

Click to download the PDB-style file with coordinates for d3cida_.
(The format of our PDB-style files is described here.)

Timeline for d3cida_: