SCOPe 2.01: Domain d3cicb_: 3cic B:

Lineage for d3cicb_ (3cic B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.2: Pepsin-like [50646] (11 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein beta-secretase (memapsin) [50671] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50672] (117 PDB entries)
   Uniprot P56817 58-446 ! Uniprot P56817 60-447

8. Domain d3cicb_: 3cic B: [156667]
   automated match to d1fkna_
   complexed with 316, tar

Details for d3cicb_

PDB Entry: 3cic, 1.75 Å

PDB Description: structure of bace bound to sch709583

PDB Compounds: (B:) Beta-secretase 1

SCOPe Domain Sequences for d3cicb_:

Sequence; same for both SEQRES and ATOM records:

>d3cicb_ b.50.1.2 (B:) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]}
gsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrql
sstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnwe
gilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsmii
ggidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrl
pkkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsf
ritilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfav
sachvhdefrtaavegpfvtldmedcgyn

Timeline for d3cicb_:

• d3cicb_ first appeared in SCOP 1.75, called d3cicb1
  
• d3cicb_ appears in SCOPe 2.02
  
• d3cicb_ appears in the current release, SCOPe 2.08