Lineage for d3ci0k3 (3ci0 K:29-93,K:275-315)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941191Fold d.24: Pili subunits [54522] (1 superfamily)
    contains very long N-terminal helix, which end is packed against beta-sheet
  4. 2941192Superfamily d.24.1: Pili subunits [54523] (8 families) (S)
    bacterial filament proteins
  5. 2941277Family d.24.1.6: GspK pilin-like domain [160132] (1 protein)
    N-terminal and C-terminal regions of Pfam PF03934
  6. 2941278Protein Pseudopilin GspK [160133] (1 species)
  7. 2941279Species Escherichia coli [TaxId:562] [160134] (1 PDB entry)
    Uniprot A7ZRI8 38-102,284-324
  8. 2941280Domain d3ci0k3: 3ci0 K:29-93,K:275-315 [156661]
    Other proteins in same PDB: d3ci0i1, d3ci0j1, d3ci0k1, d3ci0k2
    complexed with ca, cl

Details for d3ci0k3

PDB Entry: 3ci0 (more details), 2.2 Å

PDB Description: The Crystal Structure of the GspK-GspI-GspJ complex from enterotoxigenic Escherichia coli Type 2 Secretion System
PDB Compounds: (K:) Pseudopilin GspK

SCOPe Domain Sequences for d3ci0k3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ci0k3 d.24.1.6 (K:29-93,K:275-315) Pseudopilin GspK {Escherichia coli [TaxId: 562]}
grtrsqqeyqqalwysasaeslalsalslslknekrvhleqpwasgprffplpqgqiavt
lrdaqXsnyfwlrsditvneieltmnslivrmgpqhfsvlwhqtges

SCOPe Domain Coordinates for d3ci0k3:

Click to download the PDB-style file with coordinates for d3ci0k3.
(The format of our PDB-style files is described here.)

Timeline for d3ci0k3: