![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.16: GspK insert domain-like [158544] (1 family) ![]() tandem repeat of two SAM-like domains iserted into pilin fold; domain 1 contains one classic HhH motif |
![]() | Family a.60.16.1: GspK insert domain-like [158545] (1 protein) middle part of Pfam PF03934 |
![]() | Protein Pseudopilin GspK [158546] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [158547] (1 PDB entry) Uniprot A7ZRI8 103-212! Uniprot A7ZRI8 213-283 |
![]() | Domain d3ci0k2: 3ci0 K:94-203 [156660] Other proteins in same PDB: d3ci0i1, d3ci0j1, d3ci0k3 complexed with ca, cl |
PDB Entry: 3ci0 (more details), 2.2 Å
SCOPe Domain Sequences for d3ci0k2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ci0k2 a.60.16.1 (K:94-203) Pseudopilin GspK {Escherichia coli [TaxId: 562]} acfnlnalaqpttasrplavqqlialisrldvpayraeliaeslwefidedrsvqtrlgr edseylarsvpfyaanqpladisemrvvqgmdaglyqklkplvcalpmtr
Timeline for d3ci0k2: