SCOPe 2.08: Domain d3ci0k2: 3ci0 K:94-203

Lineage for d3ci0k2 (3ci0 K:94-203)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.16: GspK insert domain-like [158544] (1 family)
   tandem repeat of two SAM-like domains iserted into pilin fold; domain 1 contains one classic HhH motif

5. Family a.60.16.1: GspK insert domain-like [158545] (1 protein)
   middle part of Pfam PF03934

6. Protein Pseudopilin GspK [158546] (1 species)

7. Species Escherichia coli [TaxId:562] [158547] (1 PDB entry)
   Uniprot A7ZRI8 103-212! Uniprot A7ZRI8 213-283

8. Domain d3ci0k2: 3ci0 K:94-203 [156660]
   Other proteins in same PDB: d3ci0i1, d3ci0j1, d3ci0k3
   complexed with ca, cl

Details for d3ci0k2

PDB Entry: 3ci0, 2.2 Å

PDB Description: The Crystal Structure of the GspK-GspI-GspJ complex from enterotoxigenic Escherichia coli Type 2 Secretion System

PDB Compounds: (K:) Pseudopilin GspK

SCOPe Domain Sequences for d3ci0k2:

Sequence; same for both SEQRES and ATOM records:

>d3ci0k2 a.60.16.1 (K:94-203) Pseudopilin GspK {Escherichia coli [TaxId: 562]}
acfnlnalaqpttasrplavqqlialisrldvpayraeliaeslwefidedrsvqtrlgr
edseylarsvpfyaanqpladisemrvvqgmdaglyqklkplvcalpmtr

Timeline for d3ci0k2:

• d3ci0k2 first appeared in SCOP 1.75
  
• d3ci0k2 appears in SCOPe 2.07