SCOP 1.65: Domain d1b8db_: 1b8d B:

Lineage for d1b8db_ (1b8d B:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (6 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore

6. Protein Phycoerythrin beta subunit [88513] (4 species)

7. Species Red alga (Griffithsia monilis) [TaxId:42003] [88515] (1 PDB entry)

8. Domain d1b8db_: 1b8d B: [15666]
   Other proteins in same PDB: d1b8da_, d1b8dk_

Details for d1b8db_

PDB Entry: 1b8d, 1.9 Å

PDB Description: crystal structure of a phycourobilin-containing phycoerythrin

SCOP Domain Sequences for d1b8db_:

Sequence; same for both SEQRES and ATOM records:

>d1b8db_ a.1.1.3 (B:) Phycoerythrin beta subunit {Red alga (Griffithsia monilis)}
mldafsrvvvtsdakaayvggsdlqslksfindgnkrldavnyivsnascivsdavsgmi
cenpgliapggncytnrrmaaclrdgeiilryvsyallagdssvlddrclnglketyial
gvptasssravsimkatatafitntasgrkvevaagdcqalqaeaasyfdkvgssid

Timeline for d1b8db_:

• d1b8db_ first appeared (with stable ids) in SCOP 1.55
  
• d1b8db_ appears in SCOP 1.63
  
• d1b8db_ appears in SCOP 1.67
  
• d1b8db_ appears in the current release, SCOPe 2.08