| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (28 families) ![]() |
| Family a.118.1.7: Leukotriene A4 hydrolase C-terminal domain [63608] (1 protein) automatically mapped to Pfam PF09127 this is a repeat family; one repeat unit is 1gw6 A:513-547 found in domain |
| Protein Leukotriene A4 hydrolase C-terminal domain [63609] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [63610] (58 PDB entries) Uniprot P09960 |
| Domain d3chra1: 3chr A:461-610 [156650] Other proteins in same PDB: d3chra2, d3chra3 automated match to d3fh8a3 complexed with 4bs, imd, yb, zn |
PDB Entry: 3chr (more details), 2.2 Å
SCOPe Domain Sequences for d3chra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3chra1 a.118.1.7 (A:461-610) Leukotriene A4 hydrolase C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dmtltnacialsqrwitakeddlnsfnatdlkdlsshqlneflaqtlqraplplghikrm
qevynfnainnseirfrwlrlciqskwedaiplalkmateqgrmkftrplfkdlaafdks
hdqavrtyqehkasmhpvtamlvgkdlkvd
Timeline for d3chra1: