Lineage for d1b8da_ (1b8d A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 43952Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 43953Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 44707Family a.1.1.3: Phycocyanin-like [46532] (4 proteins)
  6. 44769Protein Phycoerythrin [46540] (5 species)
  7. 44773Species Red alga (Griffithsia monilis) [TaxId:42003] [46542] (1 PDB entry)
  8. 44774Domain d1b8da_: 1b8d A: [15665]

Details for d1b8da_

PDB Entry: 1b8d (more details), 1.9 Å

PDB Description: crystal structure of a phycourobilin-containing phycoerythrin

SCOP Domain Sequences for d1b8da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b8da_ a.1.1.3 (A:) Phycoerythrin {Red alga (Griffithsia monilis)}
mksvitttisaadaagrfpsssdlesiqgniqraaarleaaqklsgnheavvkeagdacf
akysylknageagdspekinkcyrdidhymrlinyslvvggtgpvdewgiagsrevyral
nlpgsayiaaftftrdrlcvprdmssqagveftsaldyvinslc

SCOP Domain Coordinates for d1b8da_:

Click to download the PDB-style file with coordinates for d1b8da_.
(The format of our PDB-style files is described here.)

Timeline for d1b8da_: