Lineage for d3chpa2 (3chp A:3-208)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2409030Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
    duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain
  4. 2409031Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) (S)
  5. 2409032Family b.98.1.1: Zn aminopeptidase N-terminal domain [63738] (4 protein domains)
  6. 2409048Protein Leukotriene A4 hydrolase N-terminal domain [63739] (1 species)
  7. 2409049Species Human (Homo sapiens) [TaxId:9606] [63740] (56 PDB entries)
    Uniprot P09960
  8. 2409082Domain d3chpa2: 3chp A:3-208 [156645]
    Other proteins in same PDB: d3chpa1, d3chpa3
    automated match to d3choa2
    complexed with 4bo, act, imd, yb, zn

Details for d3chpa2

PDB Entry: 3chp (more details), 2.1 Å

PDB Description: crystal structure of leukotriene a4 hydrolase in complex with (3s)-3- amino-4-oxo-4-[(4-phenylmethoxyphenyl)amino]butanoic acid
PDB Compounds: (A:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d3chpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3chpa2 b.98.1.1 (A:3-208) Leukotriene A4 hydrolase N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
ivdtcslaspasvcrtkhlhlrcsvdftrrtltgtaaltvqsqednlrslvldtkdltie
kvvingqevkyalgerqsykgspmeislpialsknqeivieisfetspkssalqwltpeq
tsgkehpylfsqcqaihcrailpcqdtpsvkltytaevsvpkelvalmsairdgetpdpe
dpsrkiykfiqkvpipcylialvvga

SCOPe Domain Coordinates for d3chpa2:

Click to download the PDB-style file with coordinates for d3chpa2.
(The format of our PDB-style files is described here.)

Timeline for d3chpa2: