Lineage for d3chdb2 (3chd B:299-360)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941336Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2941865Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 2941866Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 2941867Protein Chitinase 1 [54562] (2 species)
  7. 2941868Species Aspergillus fumigatus [TaxId:5085] [117868] (14 PDB entries)
    Uniprot Q873X9
  8. 2941878Domain d3chdb2: 3chd B:299-360 [156632]
    Other proteins in same PDB: d3chda1, d3chdb1
    automated match to d1w9pa2
    complexed with so4, wrg

Details for d3chdb2

PDB Entry: 3chd (more details), 2 Å

PDB Description: Crystal structure of Aspergillus fumigatus chitinase B1 in complex with dipeptide
PDB Compounds: (B:) chitinase

SCOPe Domain Sequences for d3chdb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3chdb2 d.26.3.1 (B:299-360) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]}
ygrsfantdgpgkpyngvgqgswengvwdykalpqagatehvlpdimasysydatnkfli
sy

SCOPe Domain Coordinates for d3chdb2:

Click to download the PDB-style file with coordinates for d3chdb2.
(The format of our PDB-style files is described here.)

Timeline for d3chdb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3chdb1