Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) |
Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins) |
Protein Chitinase 1 [54562] (2 species) |
Species Aspergillus fumigatus [TaxId:5085] [117868] (14 PDB entries) Uniprot Q873X9 |
Domain d3chda2: 3chd A:299-360 [156630] Other proteins in same PDB: d3chda1, d3chdb1 automatically matched to d1w9pa2 complexed with so4, wrg |
PDB Entry: 3chd (more details), 2 Å
SCOP Domain Sequences for d3chda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3chda2 d.26.3.1 (A:299-360) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} ygrsfantdgpgkpyngvgqgswengvwdykalpqagatehvlpdimasysydatnkfli sy
Timeline for d3chda2: