Lineage for d3ch5a_ (3ch5 A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 987698Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 988331Protein Ran [52609] (2 species)
  7. 988348Species Human (Homo sapiens) [TaxId:9606] [52611] (8 PDB entries)
  8. 988351Domain d3ch5a_: 3ch5 A: [156620]
    Other proteins in same PDB: d3ch5b_
    automated match to d1byub_
    complexed with gdp, mg, so4, zn

Details for d3ch5a_

PDB Entry: 3ch5 (more details), 2.1 Å

PDB Description: The crystal structure of the RanGDP-Nup153ZnF2 complex
PDB Compounds: (A:) GTP-binding nuclear protein ran

SCOPe Domain Sequences for d3ch5a_:

Sequence, based on SEQRES records: (download)

>d3ch5a_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]}
pqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdt
agqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdi
kdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappe
vvmdpalaaqyehdlevaq

Sequence, based on observed residues (ATOM records): (download)

>d3ch5a_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]}
pqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdt
agqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdi
kdrkvkaksinlqyydisaksnynfekpflwlarkligdpnlefvampalappevvmdpa
laaqyehdlevaq

SCOPe Domain Coordinates for d3ch5a_:

Click to download the PDB-style file with coordinates for d3ch5a_.
(The format of our PDB-style files is described here.)

Timeline for d3ch5a_: