![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein Ran [52609] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [52611] (90 PDB entries) |
![]() | Domain d3ch5a_: 3ch5 A: [156620] Other proteins in same PDB: d3ch5b_ automated match to d1byub_ complexed with gdp, mg, so4, zn has additional insertions and/or extensions that are not grouped together |
PDB Entry: 3ch5 (more details), 2.1 Å
SCOPe Domain Sequences for d3ch5a_:
Sequence, based on SEQRES records: (download)
>d3ch5a_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} pqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdt agqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdi kdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappe vvmdpalaaqyehdlevaq
>d3ch5a_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} pqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdt agqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdi kdrkvkaksinlqyydisaksnynfekpflwlarkligdpnlefvampalappevvmdpa laaqyehdlevaq
Timeline for d3ch5a_: