Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore automatically mapped to Pfam PF00502 |
Protein Phycoerythrin beta subunit [88513] (4 species) |
Species Red alga (Polysiphonia urceolata) [TaxId:65404] [88514] (1 PDB entry) |
Domain d1liab_: 1lia B: [15662] Other proteins in same PDB: d1liaa_, d1liak_ complexed with cyc, pub |
PDB Entry: 1lia (more details), 2.8 Å
SCOPe Domain Sequences for d1liab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1liab_ a.1.1.3 (B:) Phycoerythrin beta subunit {Red alga (Polysiphonia urceolata) [TaxId: 65404]} mldafsrvvvnsdskaayvsgsdlqalktfindgnkrldavnyivsnsscivsdaisgmi cenpglitpggncytnrrmaaclrdgeiilryvsyallagdasvledrclnglketyial gvptnstvravsimkaaavcfisntasqrkveviegdcsalasevasycdrvvaavs
Timeline for d1liab_: