Lineage for d3cgha1 (3cgh A:31-537)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007336Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 2007546Family a.118.8.6: SusD-like [158775] (4 protein domains)
    TPR-like structure resides in the N-terminal part; the C-terminal part is structurally unique and is covered by Pfam PF07980
  6. 2007564Protein Uncharacterized protein BT3984 [158776] (1 species)
  7. 2007565Species Bacteroides thetaiotaomicron [TaxId:818] [158777] (1 PDB entry)
    Uniprot Q8A0N7 31-537
  8. 2007566Domain d3cgha1: 3cgh A:31-537 [156618]
    complexed with act, zn

Details for d3cgha1

PDB Entry: 3cgh (more details), 1.7 Å

PDB Description: crystal structure of a susd homolog (bt_3984) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution
PDB Compounds: (A:) SusD homolog

SCOPe Domain Sequences for d3cgha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cgha1 a.118.8.6 (A:31-537) Uncharacterized protein BT3984 {Bacteroides thetaiotaomicron [TaxId: 818]}
pyeapdlsadgyalgsamnnlagcvvspdvntaqftdcllggplggyfadsnagftetis
nfnpkddwsrvflksdkiiptlysnltqvklvsqntndpvpyaiaqvikvaamhrvtdaf
gpipysqigangeiatpydsqevtyntffdelnaaiatlnensneqlvptadyiykgdvk
kwirfanslklrlairiayanpvkaqqmaeeavnpanggviesnadnatwnyfetsqnpi
yvatrynqvqtsdhggvpcltggdthaaadiicymngykdnrrekfftksewagqdyvgm
rrgivipelkttghkysgvniaptsplywmnaaevaflraegqavfnfsmggtaesfynq
girlsfeqwgadgvedylkddvnkptaytdpagtntyqnalsnitikwndsadkeekqer
iivqkwianwqlgneawadfrrtgypklipvkenksggvvdsekgarrmpypldefvsnk
anveyaianylhgadnmatdvwwaskk

SCOPe Domain Coordinates for d3cgha1:

Click to download the PDB-style file with coordinates for d3cgha1.
(The format of our PDB-style files is described here.)

Timeline for d3cgha1: