Lineage for d3cfla1 (3cfl A:342-685)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 846191Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 846192Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 846784Family c.94.1.2: Transferrin [53888] (3 proteins)
    further duplication: composed of two two-domain lobes
  6. 846785Protein Lactoferrin [53889] (6 species)
  7. 846791Species Cow (Bos taurus) [TaxId:9913] [53891] (44 PDB entries)
  8. 846808Domain d3cfla1: 3cfl A:342-685 [156613]
    automatically matched to d1nkxa_
    complexed with 5ch, co3, fe, nag, so4, zn

Details for d3cfla1

PDB Entry: 3cfl (more details), 2.25 Å

PDB Description: Crystal structure of the complex formed between C-lobe of bovine lactoferrin and 5-chloro-6'-methyl-3-[4-(methylsulfonyl)phenyl]-2,3'-bipyridine at 2.25 A resolution
PDB Compounds: (A:) lactotransferrin

SCOP Domain Sequences for d3cfla1:

Sequence, based on SEQRES records: (download)

>d3cfla1 c.94.1.2 (A:342-685) Lactoferrin {Cow (Bos taurus) [TaxId: 9913]}
ytrvvwcavgpeeqkkcqqwsqqsgqnvtcatasttddcivlvlkgeadalnldggyiyt
agkcglvpvlaenrksskhssldcvlrptegylavavvkkanegltwnslkdkkschtav
drtagwnipmglivnqtgscafdeffsqscapgadpksrlcalcagddqgldkcvpnske
kyygytgafrclaedvgdvafvkndtvwentngestadwaknlkredfrllcldgtrkpv
teaqschlavapnhavvsrsdraahveqvllhqqalfgkngkncpdkfclfksetknllf
ndnteclaklggrptyeeylgteyvtaianlkkcstsplleaca

Sequence, based on observed residues (ATOM records): (download)

>d3cfla1 c.94.1.2 (A:342-685) Lactoferrin {Cow (Bos taurus) [TaxId: 9913]}
ytrvvwcavgpeeqkkcqqwsqqsgqnvtcatasttddcivlvlkgeadalnldggyiyt
agkcglvpvlaenrksskhssldcvlrptegylavavvkkanegltwnslkdkkschtav
drtagwnipmglivnqtgscafdeffsqscapgadpksrlcalcagddqgldkcvpnske
kyygytgafrclaedvgdvafvkndtvwentngestadwaknlkredfrllcldgtrkpv
teaqschlavapnhavvsrsdraahveqvllhqqalfgkngkncpdkfclfksetknllf
ndnteclaklggrptyeeylgteyvtaianlkkcsleaca

SCOP Domain Coordinates for d3cfla1:

Click to download the PDB-style file with coordinates for d3cfla1.
(The format of our PDB-style files is described here.)

Timeline for d3cfla1: