| Class a: All alpha proteins [46456] (202 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (4 families) ![]() |
| Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (6 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore |
| Protein Phycoerythrin alpha subunit [88961] (3 species) |
| Species Red alga (Polysiphonia urceolata) [TaxId:65404] [88510] (1 PDB entry) |
| Domain d1liaa_: 1lia A: [15661] Other proteins in same PDB: d1liab_, d1lial_ |
PDB Entry: 1lia (more details), 2.8 Å
SCOP Domain Sequences for d1liaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1liaa_ a.1.1.3 (A:) Phycoerythrin alpha subunit {Red alga (Polysiphonia urceolata)}
mksvitttisaadaagrypstsdlqsvqgniqraaarleaaeklgsnheavvkeagdacf
skygynknpgeagenqekinkcyrdidhymrlinytlvvggtgpldewgiagarevyrtl
nlpsaayiaafvftrdrlciprdmsaqagvefctaldylinsls
Timeline for d1liaa_: