Lineage for d1liaa_ (1lia A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 349260Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 349261Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 350323Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (6 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
  6. 350430Protein Phycoerythrin alpha subunit [88961] (3 species)
  7. 350434Species Red alga (Polysiphonia urceolata) [TaxId:65404] [88510] (1 PDB entry)
  8. 350435Domain d1liaa_: 1lia A: [15661]
    Other proteins in same PDB: d1liab_, d1lial_

Details for d1liaa_

PDB Entry: 1lia (more details), 2.8 Å

PDB Description: crystal structure of r-phycoerythrin from polysiphonia at 2.8 a resolution

SCOP Domain Sequences for d1liaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1liaa_ a.1.1.3 (A:) Phycoerythrin alpha subunit {Red alga (Polysiphonia urceolata)}
mksvitttisaadaagrypstsdlqsvqgniqraaarleaaeklgsnheavvkeagdacf
skygynknpgeagenqekinkcyrdidhymrlinytlvvggtgpldewgiagarevyrtl
nlpsaayiaafvftrdrlciprdmsaqagvefctaldylinsls

SCOP Domain Coordinates for d1liaa_:

Click to download the PDB-style file with coordinates for d1liaa_.
(The format of our PDB-style files is described here.)

Timeline for d1liaa_: