Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species) VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species |
Species Human (Homo sapiens), cluster 3.2 [TaxId:9606] [88523] (31 PDB entries) |
Domain d3cfko1: 3cfk O:1-107 [156609] Other proteins in same PDB: d3cfka2, d3cfkb1, d3cfkb2, d3cfkc2, d3cfkd1, d3cfkd2, d3cfke2, d3cfkf1, d3cfkf2, d3cfkg2, d3cfkh1, d3cfkh2, d3cfki1, d3cfki2, d3cfkj2, d3cfkk1, d3cfkk2, d3cfkl2, d3cfkm2, d3cfkn1, d3cfkn2, d3cfko2, d3cfkp1, d3cfkp2 automatically matched to d1g9ml1 complexed with b3p, cd, gol |
PDB Entry: 3cfk (more details), 2.6 Å
SCOPe Domain Sequences for d3cfko1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cfko1 b.1.1.1 (O:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]} elvvtqesalttspgetvtltcrsssgavttsnyatwvqekpdhlftgliggtnkrapgv parfsgsligdraaltitgaqtedeaiyfcalwnsnhlvfgggtkleik
Timeline for d3cfko1:
View in 3D Domains from other chains: (mouse over for more information) d3cfka1, d3cfka2, d3cfkb1, d3cfkb2, d3cfkc1, d3cfkc2, d3cfkd1, d3cfkd2, d3cfke1, d3cfke2, d3cfkf1, d3cfkf2, d3cfkg1, d3cfkg2, d3cfkh1, d3cfkh2, d3cfki1, d3cfki2, d3cfkj1, d3cfkj2, d3cfkk1, d3cfkk2, d3cfkl1, d3cfkl2, d3cfkm1, d3cfkm2, d3cfkn1, d3cfkn2, d3cfkp1, d3cfkp2 |