Lineage for d3cfkl1 (3cfk L:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2740696Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2740853Species Human (Homo sapiens), cluster 3.2 [TaxId:9606] [88523] (31 PDB entries)
  8. 2740898Domain d3cfkl1: 3cfk L:1-107 [156603]
    Other proteins in same PDB: d3cfka2, d3cfkb1, d3cfkb2, d3cfkc2, d3cfkd1, d3cfkd2, d3cfke2, d3cfkf1, d3cfkf2, d3cfkg2, d3cfkh1, d3cfkh2, d3cfki1, d3cfki2, d3cfkj2, d3cfkk1, d3cfkk2, d3cfkl2, d3cfkm2, d3cfkn1, d3cfkn2, d3cfko2, d3cfkp1, d3cfkp2
    automatically matched to d1g9ml1
    complexed with b3p, cd, gol

Details for d3cfkl1

PDB Entry: 3cfk (more details), 2.6 Å

PDB Description: crystal structure of catalytic elimination antibody 34e4, triclinic crystal form
PDB Compounds: (L:) CATALYTIC ANTIBODY FAB 34E4 LIGHT CHAIN,Uncharacterized protein

SCOPe Domain Sequences for d3cfkl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cfkl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]}
elvvtqesalttspgetvtltcrsssgavttsnyatwvqekpdhlftgliggtnkrapgv
parfsgsligdraaltitgaqtedeaiyfcalwnsnhlvfgggtkleik

SCOPe Domain Coordinates for d3cfkl1:

Click to download the PDB-style file with coordinates for d3cfkl1.
(The format of our PDB-style files is described here.)

Timeline for d3cfkl1: