SCOPe 2.02: Domain d3cfkj2: 3cfk J:108-212

Lineage for d3cfkj2 (3cfk J:108-212)

Root: SCOPe 2.02
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)

Species Human (Homo sapiens) [TaxId:9606] [88569] (134 PDB entries)
including humanized antibodies (chimeric proteins with human constant domains)
SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody

Domain d3cfkj2: 3cfk J:108-212 [156600]
Other proteins in same PDB: d3cfka1, d3cfkb1, d3cfkb2, d3cfkc1, d3cfkd1, d3cfkd2, d3cfke1, d3cfkf1, d3cfkf2, d3cfkg1, d3cfkh1, d3cfkh2, d3cfki1, d3cfki2, d3cfkj1, d3cfkk1, d3cfkk2, d3cfkl1, d3cfkm1, d3cfkn1, d3cfkn2, d3cfko1, d3cfkp1, d3cfkp2
automatically matched to d1g9ml2
complexed with b3p, cd, gol

Details for d3cfkj2

PDB Entry: 3cfk (more details), 2.6 Å

PDB Description: crystal structure of catalytic elimination antibody 34e4, triclinic crystal form

PDB Compounds: (J:) Catalytic Antibody Fab 34E4 Light chain

SCOPe Domain Sequences for d3cfkj2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cfkj2 b.1.1.2 (J:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d3cfkj2:

Click to download the PDB-style file with coordinates for d3cfkj2.
(The format of our PDB-style files is described here.)

Timeline for d3cfkj2: