Lineage for d3cfkg2 (3cfk G:108-212)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1516253Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 1516254Species Human (Homo sapiens) [TaxId:9606] [88569] (144 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody
  8. 1516368Domain d3cfkg2: 3cfk G:108-212 [156594]
    Other proteins in same PDB: d3cfka1, d3cfkb1, d3cfkb2, d3cfkc1, d3cfkd1, d3cfkd2, d3cfke1, d3cfkf1, d3cfkf2, d3cfkg1, d3cfkh1, d3cfkh2, d3cfki1, d3cfki2, d3cfkj1, d3cfkk1, d3cfkk2, d3cfkl1, d3cfkm1, d3cfkn1, d3cfkn2, d3cfko1, d3cfkp1, d3cfkp2
    automatically matched to d1g9ml2
    complexed with b3p, cd, gol

Details for d3cfkg2

PDB Entry: 3cfk (more details), 2.6 Å

PDB Description: crystal structure of catalytic elimination antibody 34e4, triclinic crystal form
PDB Compounds: (G:) Catalytic Antibody Fab 34E4 Light chain

SCOPe Domain Sequences for d3cfkg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cfkg2 b.1.1.2 (G:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d3cfkg2:

Click to download the PDB-style file with coordinates for d3cfkg2.
(The format of our PDB-style files is described here.)

Timeline for d3cfkg2: