Lineage for d3cfkb2 (3cfk B:114-228)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1515183Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)
  7. 1515187Species Human (Homo sapiens) [TaxId:9606] [88575] (179 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody
  8. 1515328Domain d3cfkb2: 3cfk B:114-228 [156584]
    Other proteins in same PDB: d3cfka1, d3cfka2, d3cfkb1, d3cfkc1, d3cfkc2, d3cfkd1, d3cfke1, d3cfke2, d3cfkf1, d3cfkg1, d3cfkg2, d3cfkh1, d3cfki1, d3cfkj1, d3cfkj2, d3cfkk1, d3cfkl1, d3cfkl2, d3cfkm1, d3cfkm2, d3cfkn1, d3cfko1, d3cfko2, d3cfkp1
    automatically matched to d1aqkh2
    complexed with b3p, cd, gol

Details for d3cfkb2

PDB Entry: 3cfk (more details), 2.6 Å

PDB Description: crystal structure of catalytic elimination antibody 34e4, triclinic crystal form
PDB Compounds: (B:) Catalytic Antibody Fab 34E4 Heavy chain

SCOPe Domain Sequences for d3cfkb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cfkb2 b.1.1.2 (B:114-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

SCOPe Domain Coordinates for d3cfkb2:

Click to download the PDB-style file with coordinates for d3cfkb2.
(The format of our PDB-style files is described here.)

Timeline for d3cfkb2: