Lineage for d3cf5y1 (3cf5 Y:2-59)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640990Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2641696Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 2641848Family g.41.8.5: Ribosomal protein L32p [144200] (1 protein)
    Pfam PF01783; metal ion-binding site is lost in some members; includes the N-terminal, mainly helical tail
  6. 2641849Protein Ribosomal protein L32p [144201] (3 species)
  7. 2641850Species Deinococcus radiodurans [TaxId:1299] [161178] (6 PDB entries)
    Uniprot P49228 2-59
  8. 2641853Domain d3cf5y1: 3cf5 Y:2-59 [156564]
    Other proteins in same PDB: d3cf511, d3cf521, d3cf531, d3cf541, d3cf5a1, d3cf5a2, d3cf5b1, d3cf5c1, d3cf5d1, d3cf5e1, d3cf5e2, d3cf5f1, d3cf5f2, d3cf5g1, d3cf5h1, d3cf5i1, d3cf5j1, d3cf5k1, d3cf5l1, d3cf5m1, d3cf5n1, d3cf5o1, d3cf5p1, d3cf5q1, d3cf5r1, d3cf5s1, d3cf5t1, d3cf5u1, d3cf5v1, d3cf5w1
    automatically matched to 2ZJR Z:2-59
    protein/RNA complex; complexed with mg

Details for d3cf5y1

PDB Entry: 3cf5 (more details), 3.3 Å

PDB Description: thiopeptide antibiotic thiostrepton bound to the large ribosomal subunit of deinococcus radiodurans
PDB Compounds: (Y:) 50S ribosomal protein L32

SCOPe Domain Sequences for d3cf5y1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cf5y1 g.41.8.5 (Y:2-59) Ribosomal protein L32p {Deinococcus radiodurans [TaxId: 1299]}
akhpvpkkktskskrdmrrshhaltapnltecpqchgkklshhicpncgyydgrqvla

SCOPe Domain Coordinates for d3cf5y1:

Click to download the PDB-style file with coordinates for d3cf5y1.
(The format of our PDB-style files is described here.)

Timeline for d3cf5y1: