SCOPe 2.05: Domain d3cf5w1: 3cf5 W:1-55

Lineage for d3cf5w1 (3cf5 W:1-55)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily)
   core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold

4. Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family)

5. Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins)

6. Protein Prokaryotic ribosomal protein L30 [55131] (3 species)
   short-chain member of the family

7. Species Deinococcus radiodurans [TaxId:1299] [160396] (6 PDB entries)
   Uniprot Q9RSL0 1-55

8. Domain d3cf5w1: 3cf5 W:1-55 [156563]
   Other proteins in same PDB: d3cf511, d3cf521, d3cf531, d3cf541, d3cf5a1, d3cf5a2, d3cf5b1, d3cf5c1, d3cf5d1, d3cf5e1, d3cf5e2, d3cf5f1, d3cf5f2, d3cf5g1, d3cf5h1, d3cf5i1, d3cf5j1, d3cf5k1, d3cf5l1, d3cf5m1, d3cf5n1, d3cf5o1, d3cf5p1, d3cf5q1, d3cf5r1, d3cf5s1, d3cf5t1, d3cf5u1, d3cf5v1, d3cf5y1
   automatically matched to 2ZJR W:1-55
   protein/RNA complex; complexed with mg

Details for d3cf5w1

PDB Entry: 3cf5, 3.3 Å

PDB Description: thiopeptide antibiotic thiostrepton bound to the large ribosomal subunit of deinococcus radiodurans

PDB Compounds: (W:) 50S ribosomal protein L30

SCOPe Domain Sequences for d3cf5w1:

Sequence; same for both SEQRES and ATOM records:

>d3cf5w1 d.59.1.1 (W:1-55) Prokaryotic ribosomal protein L30 {Deinococcus radiodurans [TaxId: 1299]}
mkiklvrsvigrpgnqvktvqalglrkigdsrevsdtpavrgmvktvkhllevqe

Timeline for d3cf5w1:

• d3cf5w1 first appeared in SCOP 1.75
  
• d3cf5w1 appears in SCOPe 2.04
  
• d3cf5w1 appears in SCOPe 2.06
  
• d3cf5w1 appears in the current release, SCOPe 2.08