Lineage for d3cf5v1 (3cf5 V:1-66)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2303207Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2303233Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) (S)
    automatically mapped to Pfam PF00831
  5. 2303234Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)
  6. 2303235Protein Ribosomal protein L29 (L29p) [46563] (5 species)
  7. 2303236Species Deinococcus radiodurans [TaxId:1299] [158220] (8 PDB entries)
    Uniprot Q9RXJ4 1-66
  8. 2303239Domain d3cf5v1: 3cf5 V:1-66 [156562]
    Other proteins in same PDB: d3cf511, d3cf521, d3cf531, d3cf541, d3cf5a1, d3cf5a2, d3cf5b1, d3cf5c1, d3cf5d1, d3cf5e1, d3cf5e2, d3cf5f1, d3cf5f2, d3cf5g1, d3cf5h1, d3cf5i1, d3cf5j1, d3cf5k1, d3cf5l1, d3cf5m1, d3cf5n1, d3cf5o1, d3cf5p1, d3cf5q1, d3cf5r1, d3cf5s1, d3cf5t1, d3cf5u1, d3cf5w1, d3cf5y1
    automatically matched to 2ZJR V:1-66
    protein/RNA complex; complexed with mg

Details for d3cf5v1

PDB Entry: 3cf5 (more details), 3.3 Å

PDB Description: thiopeptide antibiotic thiostrepton bound to the large ribosomal subunit of deinococcus radiodurans
PDB Compounds: (V:) 50S ribosomal protein L29

SCOPe Domain Sequences for d3cf5v1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cf5v1 a.2.2.1 (V:1-66) Ribosomal protein L29 (L29p) {Deinococcus radiodurans [TaxId: 1299]}
mkpsemrnlqatdfakeidarkkelmelrfqaaagqlaqphrvrqlrrevaqlntvkael
arkgeq

SCOPe Domain Coordinates for d3cf5v1:

Click to download the PDB-style file with coordinates for d3cf5v1.
(The format of our PDB-style files is described here.)

Timeline for d3cf5v1: