SCOP 1.75: Domain d3cf5v1: 3cf5 V:1-66

Lineage for d3cf5v1 (3cf5 V:1-66)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family)

5. Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)

6. Protein Ribosomal protein L29 (L29p) [46563] (5 species)

7. Species Deinococcus radiodurans [TaxId:1299] [158220] (8 PDB entries)
   Uniprot Q9RXJ4 1-66

8. Domain d3cf5v1: 3cf5 V:1-66 [156562]
   Other proteins in same PDB: d3cf511, d3cf521, d3cf531, d3cf541, d3cf5a1, d3cf5a2, d3cf5b1, d3cf5c1, d3cf5d1, d3cf5e1, d3cf5e2, d3cf5f1, d3cf5f2, d3cf5g1, d3cf5h1, d3cf5i1, d3cf5j1, d3cf5k1, d3cf5l1, d3cf5m1, d3cf5n1, d3cf5o1, d3cf5p1, d3cf5q1, d3cf5r1, d3cf5s1, d3cf5t1, d3cf5u1, d3cf5w1, d3cf5y1
   automatically matched to 2ZJR V:1-66
   complexed with mg, txx

Details for d3cf5v1

PDB Entry: 3cf5, 3.3 Å

PDB Description: thiopeptide antibiotic thiostrepton bound to the large ribosomal subunit of deinococcus radiodurans

PDB Compounds: (V:) 50S ribosomal protein L29

SCOP Domain Sequences for d3cf5v1:

Sequence; same for both SEQRES and ATOM records:

>d3cf5v1 a.2.2.1 (V:1-66) Ribosomal protein L29 (L29p) {Deinococcus radiodurans [TaxId: 1299]}
mkpsemrnlqatdfakeidarkkelmelrfqaaagqlaqphrvrqlrrevaqlntvkael
arkgeq

Timeline for d3cf5v1:

• d3cf5v1 is new in SCOP 1.75
  
• d3cf5v1 appears in SCOPe 2.01
  
• d3cf5v1 appears in the current release, SCOPe 2.08