Lineage for d3cf5q1 (3cf5 Q:2-94)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2175862Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 2175863Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) (S)
  5. 2175864Family d.12.1.1: L23p [54190] (1 protein)
    automatically mapped to Pfam PF00276
  6. 2175865Protein Ribosomal protein L23 [54191] (4 species)
  7. 2175866Species Deinococcus radiodurans [TaxId:1299] [159877] (8 PDB entries)
    Uniprot Q9RXK0 2-94
  8. 2175869Domain d3cf5q1: 3cf5 Q:2-94 [156557]
    Other proteins in same PDB: d3cf511, d3cf521, d3cf531, d3cf541, d3cf5a1, d3cf5a2, d3cf5b1, d3cf5c1, d3cf5d1, d3cf5e1, d3cf5e2, d3cf5f1, d3cf5f2, d3cf5g1, d3cf5h1, d3cf5i1, d3cf5j1, d3cf5k1, d3cf5l1, d3cf5m1, d3cf5n1, d3cf5o1, d3cf5p1, d3cf5r1, d3cf5s1, d3cf5t1, d3cf5u1, d3cf5v1, d3cf5w1, d3cf5y1
    automatically matched to 2ZJR Q:2-94
    protein/RNA complex; complexed with mg

Details for d3cf5q1

PDB Entry: 3cf5 (more details), 3.3 Å

PDB Description: thiopeptide antibiotic thiostrepton bound to the large ribosomal subunit of deinococcus radiodurans
PDB Compounds: (Q:) 50S ribosomal protein L23

SCOPe Domain Sequences for d3cf5q1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cf5q1 d.12.1.1 (Q:2-94) Ribosomal protein L23 {Deinococcus radiodurans [TaxId: 1299]}
shydilqapvisekaysamergvysfwvspkatkteikdaiqqafgvrvigistmnvpgk
rkrvgrfigqrndrkkaivrlaegqsiealagq

SCOPe Domain Coordinates for d3cf5q1:

Click to download the PDB-style file with coordinates for d3cf5q1.
(The format of our PDB-style files is described here.)

Timeline for d3cf5q1: