SCOPe 2.05: Domain d3cf5q1: 3cf5 Q:2-94

Lineage for d3cf5q1 (3cf5 Q:2-94)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
   beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243

4. Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families)

5. Family d.12.1.1: L23p [54190] (1 protein)
   automatically mapped to Pfam PF00276

6. Protein Ribosomal protein L23 [54191] (4 species)

7. Species Deinococcus radiodurans [TaxId:1299] [159877] (8 PDB entries)
   Uniprot Q9RXK0 2-94

8. Domain d3cf5q1: 3cf5 Q:2-94 [156557]
   Other proteins in same PDB: d3cf511, d3cf521, d3cf531, d3cf541, d3cf5a1, d3cf5a2, d3cf5b1, d3cf5c1, d3cf5d1, d3cf5e1, d3cf5e2, d3cf5f1, d3cf5f2, d3cf5g1, d3cf5h1, d3cf5i1, d3cf5j1, d3cf5k1, d3cf5l1, d3cf5m1, d3cf5n1, d3cf5o1, d3cf5p1, d3cf5r1, d3cf5s1, d3cf5t1, d3cf5u1, d3cf5v1, d3cf5w1, d3cf5y1
   automatically matched to 2ZJR Q:2-94
   protein/RNA complex; complexed with mg

Details for d3cf5q1

PDB Entry: 3cf5, 3.3 Å

PDB Description: thiopeptide antibiotic thiostrepton bound to the large ribosomal subunit of deinococcus radiodurans

PDB Compounds: (Q:) 50S ribosomal protein L23

SCOPe Domain Sequences for d3cf5q1:

Sequence; same for both SEQRES and ATOM records:

>d3cf5q1 d.12.1.1 (Q:2-94) Ribosomal protein L23 {Deinococcus radiodurans [TaxId: 1299]}
shydilqapvisekaysamergvysfwvspkatkteikdaiqqafgvrvigistmnvpgk
rkrvgrfigqrndrkkaivrlaegqsiealagq

Timeline for d3cf5q1:

• d3cf5q1 first appeared in SCOP 1.75
  
• d3cf5q1 appears in SCOPe 2.04
  
• d3cf5q1 appears in SCOPe 2.06
  
• d3cf5q1 appears in the current release, SCOPe 2.08