Lineage for d3cf5o1 (3cf5 O:5-98)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1814802Fold b.155: L21p-like [141090] (1 superfamily)
    core: sandwich, 6 strands in 2 sheets
  4. 1814803Superfamily b.155.1: L21p-like [141091] (1 family) (S)
    automatically mapped to Pfam PF00829
  5. 1814804Family b.155.1.1: Ribosomal protein L21p [141092] (1 protein)
    Pfam PF00829
  6. 1814805Protein Ribosomal protein L21p [141093] (3 species)
  7. 1814806Species Deinococcus radiodurans [TaxId:1299] [158938] (6 PDB entries)
    Uniprot Q9RY64 5-98
  8. 1814808Domain d3cf5o1: 3cf5 O:5-98 [156555]
    Other proteins in same PDB: d3cf511, d3cf521, d3cf531, d3cf541, d3cf5a1, d3cf5a2, d3cf5b1, d3cf5c1, d3cf5d1, d3cf5e1, d3cf5e2, d3cf5f1, d3cf5f2, d3cf5g1, d3cf5h1, d3cf5i1, d3cf5j1, d3cf5k1, d3cf5l1, d3cf5m1, d3cf5n1, d3cf5p1, d3cf5q1, d3cf5r1, d3cf5s1, d3cf5t1, d3cf5u1, d3cf5v1, d3cf5w1, d3cf5y1
    automatically matched to 2ZJR O:5-98
    protein/RNA complex; complexed with mg

Details for d3cf5o1

PDB Entry: 3cf5 (more details), 3.3 Å

PDB Description: thiopeptide antibiotic thiostrepton bound to the large ribosomal subunit of deinococcus radiodurans
PDB Compounds: (O:) 50S ribosomal protein L21

SCOPe Domain Sequences for d3cf5o1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cf5o1 b.155.1.1 (O:5-98) Ribosomal protein L21p {Deinococcus radiodurans [TaxId: 1299]}
iqtggkqyrvsegdvirveslqgeagdkvelkalfvggeqtvfgedagkytvqaevvehg
rgkkiyirkyksgvqyrrrtghrqnftaikilgi

SCOPe Domain Coordinates for d3cf5o1:

Click to download the PDB-style file with coordinates for d3cf5o1.
(The format of our PDB-style files is described here.)

Timeline for d3cf5o1: