Lineage for d3cf5n1 (3cf5 N:2-118)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 778923Fold a.144: PABP domain-like [63569] (2 superfamilies)
    4 helices; an orthogonal array
  4. 778938Superfamily a.144.2: Ribosomal protein L20 [74731] (1 family) (S)
  5. 778939Family a.144.2.1: Ribosomal protein L20 [74732] (1 protein)
  6. 778940Protein Ribosomal protein L20 [74733] (4 species)
  7. 778943Species Deinococcus radiodurans [TaxId:1299] [158512] (10 PDB entries)
    Uniprot Q9RSW7 2-118
  8. 778947Domain d3cf5n1: 3cf5 N:2-118 [156554]
    Other proteins in same PDB: d3cf511, d3cf521, d3cf531, d3cf541, d3cf5a1, d3cf5a2, d3cf5b1, d3cf5c1, d3cf5d1, d3cf5e1, d3cf5e2, d3cf5f1, d3cf5f2, d3cf5g1, d3cf5h1, d3cf5i1, d3cf5j1, d3cf5k1, d3cf5l1, d3cf5m1, d3cf5o1, d3cf5p1, d3cf5q1, d3cf5r1, d3cf5s1, d3cf5t1, d3cf5u1, d3cf5v1, d3cf5w1, d3cf5y1
    automatically matched to 2ZJR N:2-118
    complexed with mg, txx

Details for d3cf5n1

PDB Entry: 3cf5 (more details), 3.3 Å

PDB Description: thiopeptide antibiotic thiostrepton bound to the large ribosomal subunit of deinococcus radiodurans
PDB Compounds: (N:) 50S ribosomal protein L20

SCOP Domain Sequences for d3cf5n1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cf5n1 a.144.2.1 (N:2-118) Ribosomal protein L20 {Deinococcus radiodurans [TaxId: 1299]}
praktgivrrrrhkkvlkrakgfwgsrskqyrnafqtllnaatyeyrdrrnkkrdfrrlw
iqrinagarlhgmnystfinglkranidlnrkvladiaarepeafkalvdasrnarq

SCOP Domain Coordinates for d3cf5n1:

Click to download the PDB-style file with coordinates for d3cf5n1.
(The format of our PDB-style files is described here.)

Timeline for d3cf5n1: