Lineage for d3cf5l1 (3cf5 L:8-111)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2495356Superfamily c.55.4: Translational machinery components [53137] (3 families) (S)
  5. 2495357Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 2495358Protein Ribosomal protein L18 (L18p) [53139] (5 species)
  7. 2495361Species Deinococcus radiodurans [TaxId:1299] [159643] (6 PDB entries)
    Uniprot Q9RSL2 8-111
  8. 2495364Domain d3cf5l1: 3cf5 L:8-111 [156552]
    Other proteins in same PDB: d3cf511, d3cf521, d3cf531, d3cf541, d3cf5a1, d3cf5a2, d3cf5b1, d3cf5c1, d3cf5d1, d3cf5e1, d3cf5e2, d3cf5f1, d3cf5f2, d3cf5g1, d3cf5h1, d3cf5i1, d3cf5j1, d3cf5k1, d3cf5m1, d3cf5n1, d3cf5o1, d3cf5p1, d3cf5q1, d3cf5r1, d3cf5s1, d3cf5t1, d3cf5u1, d3cf5v1, d3cf5w1, d3cf5y1
    automatically matched to 2ZJR L:8-111
    protein/RNA complex; complexed with mg

Details for d3cf5l1

PDB Entry: 3cf5 (more details), 3.3 Å

PDB Description: thiopeptide antibiotic thiostrepton bound to the large ribosomal subunit of deinococcus radiodurans
PDB Compounds: (L:) 50S ribosomal protein L18

SCOPe Domain Sequences for d3cf5l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cf5l1 c.55.4.1 (L:8-111) Ribosomal protein L18 (L18p) {Deinococcus radiodurans [TaxId: 1299]}
rrklrtrrkvrtttaasgrlrlsvyrsskhiyaqiiddsrgqtlaaassaalksgnktdt
aaavgkalaaaaaekgikqvvfdrgsykyhgrvkaladaaregg

SCOPe Domain Coordinates for d3cf5l1:

Click to download the PDB-style file with coordinates for d3cf5l1.
(The format of our PDB-style files is described here.)

Timeline for d3cf5l1: