Lineage for d3cf5k1 (3cf5 K:3-115)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 879673Fold d.188: Prokaryotic ribosomal protein L17 [64262] (1 superfamily)
    alpha-beta-alpha(3)-beta(2); 2 layers: alpha/beta;
  4. 879674Superfamily d.188.1: Prokaryotic ribosomal protein L17 [64263] (1 family) (S)
    some topological similarity to ribosomal protein L22
  5. 879675Family d.188.1.1: Prokaryotic ribosomal protein L17 [64264] (1 protein)
  6. 879676Protein Prokaryotic ribosomal protein L17 [64265] (4 species)
  7. 879677Species Deinococcus radiodurans [TaxId:1299] [160268] (6 PDB entries)
    Uniprot Q9RSJ5 3-115
  8. 879681Domain d3cf5k1: 3cf5 K:3-115 [156551]
    Other proteins in same PDB: d3cf511, d3cf521, d3cf531, d3cf541, d3cf5a1, d3cf5a2, d3cf5b1, d3cf5c1, d3cf5d1, d3cf5e1, d3cf5e2, d3cf5f1, d3cf5f2, d3cf5g1, d3cf5h1, d3cf5i1, d3cf5j1, d3cf5l1, d3cf5m1, d3cf5n1, d3cf5o1, d3cf5p1, d3cf5q1, d3cf5r1, d3cf5s1, d3cf5t1, d3cf5u1, d3cf5v1, d3cf5w1, d3cf5y1
    automatically matched to 2ZJR K:3-115
    complexed with mg, txx

Details for d3cf5k1

PDB Entry: 3cf5 (more details), 3.3 Å

PDB Description: thiopeptide antibiotic thiostrepton bound to the large ribosomal subunit of deinococcus radiodurans
PDB Compounds: (K:) 50S ribosomal protein L17

SCOP Domain Sequences for d3cf5k1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cf5k1 d.188.1.1 (K:3-115) Prokaryotic ribosomal protein L17 {Deinococcus radiodurans [TaxId: 1299]}
hgkagrklnrnssarvalaraqatallregriqttltkakelrpfveqlittakggdlhs
rrlvaqdihdkdvvrkvmdevapkyaerpggytrilrvgtrrgdgvtmaliel

SCOP Domain Coordinates for d3cf5k1:

Click to download the PDB-style file with coordinates for d3cf5k1.
(The format of our PDB-style files is described here.)

Timeline for d3cf5k1: