Lineage for d3cf5j1 (3cf5 J:6-141)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2188935Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2189212Superfamily d.41.4: Ribosomal protein L16p/L10e [54686] (2 families) (S)
  5. 2189277Family d.41.4.2: Ribosomal protein L16p [117888] (1 protein)
    Pfam PF00252
  6. 2189278Protein Ribosomal protein L16p [117889] (4 species)
  7. 2189279Species Deinococcus radiodurans [TaxId:1299] [160196] (6 PDB entries)
    Uniprot Q9RXJ5 5-140
  8. 2189283Domain d3cf5j1: 3cf5 J:6-141 [156550]
    Other proteins in same PDB: d3cf511, d3cf521, d3cf531, d3cf541, d3cf5a1, d3cf5a2, d3cf5b1, d3cf5c1, d3cf5d1, d3cf5e1, d3cf5e2, d3cf5f1, d3cf5f2, d3cf5g1, d3cf5h1, d3cf5i1, d3cf5k1, d3cf5l1, d3cf5m1, d3cf5n1, d3cf5o1, d3cf5p1, d3cf5q1, d3cf5r1, d3cf5s1, d3cf5t1, d3cf5u1, d3cf5v1, d3cf5w1, d3cf5y1
    automatically matched to 2ZJR J:6-141
    protein/RNA complex; complexed with mg

Details for d3cf5j1

PDB Entry: 3cf5 (more details), 3.3 Å

PDB Description: thiopeptide antibiotic thiostrepton bound to the large ribosomal subunit of deinococcus radiodurans
PDB Compounds: (J:) 50S ribosomal protein L16

SCOPe Domain Sequences for d3cf5j1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cf5j1 d.41.4.2 (J:6-141) Ribosomal protein L16p {Deinococcus radiodurans [TaxId: 1299]}
krtkfrkqfrgrmtgdakggdyvafgdygliamepawiksnqieacrivmsrhfrrggki
yirifpdkpvtkkpaetrmgkgkgaveywvsvvkpgrvmfevagvteeqakeafrlaghk
lpiqtkmvkrevydea

SCOPe Domain Coordinates for d3cf5j1:

Click to download the PDB-style file with coordinates for d3cf5j1.
(The format of our PDB-style files is described here.)

Timeline for d3cf5j1: